Placeholder image of a protein
Icon representing a puzzle

2092: Revisiting Puzzle 97: Pig

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
January 06, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,199
  2. Avatar for Beta Folders 2. Beta Folders 74 pts. 11,186
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 54 pts. 11,123
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 11,096
  5. Avatar for Contenders 5. Contenders 27 pts. 10,758
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 10,744
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 10,683
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 10,681
  9. Avatar for Australia 9. Australia 5 pts. 10,236
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 3 pts. 9,690
  1. Avatar for frostschutz 71. frostschutz Lv 1 7 pts. 9,582
  2. Avatar for DScott 72. DScott Lv 1 6 pts. 9,571
  3. Avatar for Wiz kid 73. Wiz kid Lv 1 6 pts. 9,565
  4. Avatar for Larini 74. Larini Lv 1 6 pts. 9,550
  5. Avatar for Arne Heessels 75. Arne Heessels Lv 1 5 pts. 9,539
  6. Avatar for Dr.Sillem 76. Dr.Sillem Lv 1 5 pts. 9,524
  7. Avatar for pfirth 77. pfirth Lv 1 5 pts. 9,502
  8. Avatar for tracybutt 78. tracybutt Lv 1 5 pts. 9,500
  9. Avatar for pizpot 79. pizpot Lv 1 4 pts. 9,490
  10. Avatar for AlphaFold2 80. AlphaFold2 Lv 1 4 pts. 9,458

Comments