Placeholder image of a protein
Icon representing a puzzle

2092: Revisiting Puzzle 97: Pig

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
January 06, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for foldeRNA 11. foldeRNA 2 pts. 9,638
  2. Avatar for AlphaFold 12. AlphaFold 1 pt. 9,458
  3. Avatar for BC125_Buco,Palisoc,Torre 13. BC125_Buco,Palisoc,Torre 1 pt. 9,270
  4. Avatar for Team China 14. Team China 1 pt. 8,874
  5. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 8,799
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,730
  7. Avatar for Trinity Biology 17. Trinity Biology 1 pt. 8,639
  8. Avatar for pikem125 18. pikem125 1 pt. 8,613
  1. Avatar for Evica 81. Evica Lv 1 4 pts. 9,448
  2. Avatar for lconor 82. lconor Lv 1 4 pts. 9,434
  3. Avatar for Alistair69 83. Alistair69 Lv 1 4 pts. 9,359
  4. Avatar for Beany 84. Beany Lv 1 3 pts. 9,342
  5. Avatar for Lpnt 85. Lpnt Lv 1 3 pts. 9,334
  6. Avatar for ManVsYard 86. ManVsYard Lv 1 3 pts. 9,304
  7. Avatar for ume 87. ume Lv 1 3 pts. 9,291
  8. Avatar for PaulaBuco 88. PaulaBuco Lv 1 3 pts. 9,270
  9. Avatar for Kraiza 89. Kraiza Lv 1 3 pts. 9,255
  10. Avatar for Bullald 90. Bullald Lv 1 2 pts. 9,222

Comments