Placeholder image of a protein
Icon representing a puzzle

2092: Revisiting Puzzle 97: Pig

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
January 06, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,199
  2. Avatar for Beta Folders 2. Beta Folders 74 pts. 11,186
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 54 pts. 11,123
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 11,096
  5. Avatar for Contenders 5. Contenders 27 pts. 10,758
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 10,744
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 10,683
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 10,681
  9. Avatar for Australia 9. Australia 5 pts. 10,236
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 3 pts. 9,690
  1. Avatar for Evica 81. Evica Lv 1 4 pts. 9,448
  2. Avatar for lconor 82. lconor Lv 1 4 pts. 9,434
  3. Avatar for Alistair69 83. Alistair69 Lv 1 4 pts. 9,359
  4. Avatar for Beany 84. Beany Lv 1 3 pts. 9,342
  5. Avatar for Lpnt 85. Lpnt Lv 1 3 pts. 9,334
  6. Avatar for ManVsYard 86. ManVsYard Lv 1 3 pts. 9,304
  7. Avatar for ume 87. ume Lv 1 3 pts. 9,291
  8. Avatar for PaulaBuco 88. PaulaBuco Lv 1 3 pts. 9,270
  9. Avatar for Kraiza 89. Kraiza Lv 1 3 pts. 9,255
  10. Avatar for Bullald 90. Bullald Lv 1 2 pts. 9,222

Comments