Placeholder image of a protein
Icon representing a puzzle

2092: Revisiting Puzzle 97: Pig

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
January 06, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,199
  2. Avatar for Beta Folders 2. Beta Folders 74 pts. 11,186
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 54 pts. 11,123
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 11,096
  5. Avatar for Contenders 5. Contenders 27 pts. 10,758
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 10,744
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 10,683
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 10,681
  9. Avatar for Australia 9. Australia 5 pts. 10,236
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 3 pts. 9,690
  1. Avatar for georg137 41. georg137 Lv 1 25 pts. 10,307
  2. Avatar for RockOn 42. RockOn Lv 1 24 pts. 10,304
  3. Avatar for fishercat 43. fishercat Lv 1 23 pts. 10,285
  4. Avatar for manu8170 44. manu8170 Lv 1 22 pts. 10,261
  5. Avatar for AlkiP0Ps 45. AlkiP0Ps Lv 1 21 pts. 10,236
  6. Avatar for ProfVince 46. ProfVince Lv 1 20 pts. 10,232
  7. Avatar for heather-1 47. heather-1 Lv 1 20 pts. 10,221
  8. Avatar for zippyc137 48. zippyc137 Lv 1 19 pts. 10,190
  9. Avatar for jamiexq 49. jamiexq Lv 1 18 pts. 10,129
  10. Avatar for NeLikomSheet 50. NeLikomSheet Lv 1 17 pts. 10,093

Comments