Placeholder image of a protein
Icon representing a puzzle

2098: Revisiting Puzzle 110: Turkey

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
January 20, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,410
  2. Avatar for 2022_MUfolders 12. 2022_MUfolders 1 pt. 9,221
  3. Avatar for AlphaFold 13. AlphaFold 1 pt. 9,156
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 8,528
  5. Avatar for Team China 15. Team China 1 pt. 8,075
  6. Avatar for test 2 16. test 2 1 pt. 5,122
  1. Avatar for jacobdjohnston23@gmail.com 141. jacobdjohnston23@gmail.com Lv 1 1 pt. 7,370
  2. Avatar for Coasean Penguin 142. Coasean Penguin Lv 1 1 pt. 7,358
  3. Avatar for hckmaster 143. hckmaster Lv 1 1 pt. 5,976
  4. Avatar for Invictus99 144. Invictus99 Lv 1 1 pt. 5,447
  5. Avatar for f248schumi 145. f248schumi Lv 1 1 pt. 5,392
  6. Avatar for joel osores 146. joel osores Lv 1 1 pt. 5,371
  7. Avatar for AsiyaA 147. AsiyaA Lv 1 1 pt. 5,335
  8. Avatar for fantafav21 148. fantafav21 Lv 1 1 pt. 5,325
  9. Avatar for MARIONEtt55 149. MARIONEtt55 Lv 1 1 pt. 5,319
  10. Avatar for Daniel Gross 150. Daniel Gross Lv 1 1 pt. 5,306

Comments