Placeholder image of a protein
Icon representing a puzzle

2098: Revisiting Puzzle 110: Turkey

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
January 20, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,410
  2. Avatar for 2022_MUfolders 12. 2022_MUfolders 1 pt. 9,221
  3. Avatar for AlphaFold 13. AlphaFold 1 pt. 9,156
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 8,528
  5. Avatar for Team China 15. Team China 1 pt. 8,075
  6. Avatar for test 2 16. test 2 1 pt. 5,122
  1. Avatar for PacificScienceCenter 171. PacificScienceCenter Lv 1 1 pt. 5,122
  2. Avatar for Sciren 172. Sciren Lv 1 1 pt. 5,122
  3. Avatar for toshiue 173. toshiue Lv 1 1 pt. 5,122
  4. Avatar for joshtest01 174. joshtest01 Lv 1 1 pt. 5,122
  5. Avatar for bkoep 175. bkoep Lv 1 1 pt. 5,122
  6. Avatar for Folding@TheRoost 176. Folding@TheRoost Lv 1 1 pt. 5,122
  7. Avatar for beep beep kar 177. beep beep kar Lv 1 1 pt. 5,122
  8. Avatar for P4UL-IE 178. P4UL-IE Lv 1 1 pt. 5,122

Comments