Placeholder image of a protein
Icon representing a puzzle

2098: Revisiting Puzzle 110: Turkey

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
January 20, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,410
  2. Avatar for 2022_MUfolders 12. 2022_MUfolders 1 pt. 9,221
  3. Avatar for AlphaFold 13. AlphaFold 1 pt. 9,156
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 8,528
  5. Avatar for Team China 15. Team China 1 pt. 8,075
  6. Avatar for test 2 16. test 2 1 pt. 5,122
  1. Avatar for Arthuriel 31. Arthuriel Lv 1 40 pts. 10,150
  2. Avatar for Alistair69 32. Alistair69 Lv 1 39 pts. 10,114
  3. Avatar for BarrySampson 33. BarrySampson Lv 1 37 pts. 10,097
  4. Avatar for robgee 34. robgee Lv 1 36 pts. 10,096
  5. Avatar for bamh 35. bamh Lv 1 35 pts. 10,092
  6. Avatar for manu8170 36. manu8170 Lv 1 34 pts. 10,084
  7. Avatar for Lotus23 37. Lotus23 Lv 1 33 pts. 10,083
  8. Avatar for zackallen 38. zackallen Lv 1 31 pts. 10,072
  9. Avatar for kevin everington 39. kevin everington Lv 1 30 pts. 10,069
  10. Avatar for szinr 40. szinr Lv 1 29 pts. 10,061

Comments