Placeholder image of a protein
Icon representing a puzzle

2098: Revisiting Puzzle 110: Turkey

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
January 20, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,410
  2. Avatar for 2022_MUfolders 12. 2022_MUfolders 1 pt. 9,221
  3. Avatar for AlphaFold 13. AlphaFold 1 pt. 9,156
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 8,528
  5. Avatar for Team China 15. Team China 1 pt. 8,075
  6. Avatar for test 2 16. test 2 1 pt. 5,122
  1. Avatar for infjamc 51. infjamc Lv 1 20 pts. 9,831
  2. Avatar for Merf 52. Merf Lv 1 19 pts. 9,829
  3. Avatar for Deleted player 53. Deleted player 18 pts. 9,824
  4. Avatar for zippyc137 54. zippyc137 Lv 1 17 pts. 9,776
  5. Avatar for Oransche 55. Oransche Lv 1 17 pts. 9,776
  6. Avatar for jausmh 56. jausmh Lv 1 16 pts. 9,747
  7. Avatar for carxo 57. carxo Lv 1 15 pts. 9,725
  8. Avatar for Larini 58. Larini Lv 1 15 pts. 9,721
  9. Avatar for phi16 59. phi16 Lv 1 14 pts. 9,702
  10. Avatar for AlkiP0Ps 60. AlkiP0Ps Lv 1 14 pts. 9,702

Comments