Placeholder image of a protein
Icon representing a puzzle

2107: Revisiting Puzzle 113: White Birch

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
February 10, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,963
  2. Avatar for Beta Folders 2. Beta Folders 70 pts. 10,849
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 47 pts. 10,842
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 10,786
  5. Avatar for Contenders 5. Contenders 19 pts. 10,786
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 10,695
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 10,649
  8. Avatar for BOINC@Poland 8. BOINC@Poland 4 pts. 10,305
  9. Avatar for Void Crushers 9. Void Crushers 2 pts. 10,262
  10. Avatar for Australia 10. Australia 1 pt. 9,953
  1. Avatar for ShangLan 111. ShangLan Lv 1 1 pt. 8,181
  2. Avatar for justindang 112. justindang Lv 1 1 pt. 8,175
  3. Avatar for thomas ocaranza 113. thomas ocaranza Lv 1 1 pt. 7,234
  4. Avatar for sadegh.rizi 114. sadegh.rizi Lv 1 1 pt. 6,520
  5. Avatar for ShubhaG 115. ShubhaG Lv 1 1 pt. 6,483
  6. Avatar for matias13 116. matias13 Lv 1 1 pt. 6,384
  7. Avatar for Cygnus312 117. Cygnus312 Lv 1 1 pt. 6,281
  8. Avatar for UnionBerlin 118. UnionBerlin Lv 1 1 pt. 6,046
  9. Avatar for John3rd 119. John3rd Lv 1 1 pt. 5,956
  10. Avatar for cookiemonster5917 120. cookiemonster5917 Lv 1 1 pt. 5,623

Comments