Placeholder image of a protein
Icon representing a puzzle

2107: Revisiting Puzzle 113: White Birch

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
February 10, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,963
  2. Avatar for Beta Folders 2. Beta Folders 70 pts. 10,849
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 47 pts. 10,842
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 10,786
  5. Avatar for Contenders 5. Contenders 19 pts. 10,786
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 10,695
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 10,649
  8. Avatar for BOINC@Poland 8. BOINC@Poland 4 pts. 10,305
  9. Avatar for Void Crushers 9. Void Crushers 2 pts. 10,262
  10. Avatar for Australia 10. Australia 1 pt. 9,953
  1. Avatar for AminHashemi 91. AminHashemi Lv 1 1 pt. 9,342
  2. Avatar for CB20HILT 92. CB20HILT Lv 1 1 pt. 9,280
  3. Avatar for pruneau_44 93. pruneau_44 Lv 1 1 pt. 9,263
  4. Avatar for FuelPumpedFrog 94. FuelPumpedFrog Lv 1 1 pt. 9,258
  5. Avatar for Mohoernchen 95. Mohoernchen Lv 1 1 pt. 9,256
  6. Avatar for artsyambie6 96. artsyambie6 Lv 1 1 pt. 9,243
  7. Avatar for Sciren 97. Sciren Lv 1 1 pt. 9,202
  8. Avatar for RonEthan 98. RonEthan Lv 1 1 pt. 9,193
  9. Avatar for botanicalblues 99. botanicalblues Lv 1 1 pt. 9,158
  10. Avatar for Shado165 100. Shado165 Lv 1 1 pt. 9,120

Comments