Placeholder image of a protein
Icon representing a puzzle

2107: Revisiting Puzzle 113: White Birch

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
February 10, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,963
  2. Avatar for Beta Folders 2. Beta Folders 70 pts. 10,849
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 47 pts. 10,842
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 10,786
  5. Avatar for Contenders 5. Contenders 19 pts. 10,786
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 10,695
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 10,649
  8. Avatar for BOINC@Poland 8. BOINC@Poland 4 pts. 10,305
  9. Avatar for Void Crushers 9. Void Crushers 2 pts. 10,262
  10. Avatar for Australia 10. Australia 1 pt. 9,953
  1. Avatar for gmn 11. gmn Lv 1 70 pts. 10,713
  2. Avatar for Punzi Baker 2 12. Punzi Baker 2 Lv 1 67 pts. 10,705
  3. Avatar for Blipperman 13. Blipperman Lv 1 64 pts. 10,695
  4. Avatar for akaaka 14. akaaka Lv 1 62 pts. 10,677
  5. Avatar for dcrwheeler 15. dcrwheeler Lv 1 60 pts. 10,664
  6. Avatar for g_b 16. g_b Lv 1 57 pts. 10,658
  7. Avatar for Deleted player 17. Deleted player 55 pts. 10,655
  8. Avatar for jobo0502 18. jobo0502 Lv 1 53 pts. 10,649
  9. Avatar for christioanchauvin 19. christioanchauvin Lv 1 51 pts. 10,645
  10. Avatar for Deleted player 20. Deleted player pts. 10,617

Comments