Placeholder image of a protein
Icon representing a puzzle

2107: Revisiting Puzzle 113: White Birch

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
February 10, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,963
  2. Avatar for Beta Folders 2. Beta Folders 70 pts. 10,849
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 47 pts. 10,842
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 10,786
  5. Avatar for Contenders 5. Contenders 19 pts. 10,786
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 10,695
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 10,649
  8. Avatar for BOINC@Poland 8. BOINC@Poland 4 pts. 10,305
  9. Avatar for Void Crushers 9. Void Crushers 2 pts. 10,262
  10. Avatar for Australia 10. Australia 1 pt. 9,953
  1. Avatar for WBarme1234 21. WBarme1234 Lv 1 47 pts. 10,595
  2. Avatar for frood66 22. frood66 Lv 1 45 pts. 10,594
  3. Avatar for Sandrix72 23. Sandrix72 Lv 1 43 pts. 10,591
  4. Avatar for guineapig 24. guineapig Lv 1 41 pts. 10,570
  5. Avatar for infjamc 25. infjamc Lv 1 40 pts. 10,563
  6. Avatar for georg137 26. georg137 Lv 1 38 pts. 10,559
  7. Avatar for Lotus23 27. Lotus23 Lv 1 36 pts. 10,544
  8. Avatar for BarrySampson 28. BarrySampson Lv 1 35 pts. 10,538
  9. Avatar for fiendish_ghoul 29. fiendish_ghoul Lv 1 33 pts. 10,514
  10. Avatar for borattt 30. borattt Lv 1 32 pts. 10,493

Comments