Placeholder image of a protein
Icon representing a puzzle

2108: Electron Density Reconstruction 4

Closed since about 4 years ago

Novice Overall Prediction Electron Density

Summary

Created
February 11, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes three sulfate ions that are fixed in place.



Sequence:


KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV

Top groups

  1. Avatar for Marvin's bunch
    1. Marvin's bunch
    100 pts. 20,122
  2. Avatar for Go Science 2. Go Science 68 pts. 20,053
  3. Avatar for Beta Folders 3. Beta Folders 44 pts. 19,990
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 27 pts. 19,990
  5. Avatar for Contenders 5. Contenders 16 pts. 19,968
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 19,840
  7. Avatar for Gargleblasters 7. Gargleblasters 5 pts. 19,713
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 3 pts. 19,552
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 19,461
  10. Avatar for VeFold 10. VeFold 1 pt. 18,879
  1. Avatar for Beany 51. Beany Lv 1 4 pts. 18,959
  2. Avatar for abiogenesis 52. abiogenesis Lv 1 4 pts. 18,892
  3. Avatar for fpc 53. fpc Lv 1 4 pts. 18,882
  4. Avatar for carxo 54. carxo Lv 1 3 pts. 18,879
  5. Avatar for Zosa 55. Zosa Lv 1 3 pts. 18,829
  6. Avatar for rezaefar 56. rezaefar Lv 1 3 pts. 18,747
  7. Avatar for AlkiP0Ps 57. AlkiP0Ps Lv 1 3 pts. 18,731
  8. Avatar for BarrySampson 58. BarrySampson Lv 1 2 pts. 18,594
  9. Avatar for ManVsYard 59. ManVsYard Lv 1 2 pts. 18,580
  10. Avatar for Wiz kid 60. Wiz kid Lv 1 2 pts. 18,575

Comments