Placeholder image of a protein
Icon representing a puzzle

2114: Electron Density Reconstruction 5

Closed since about 4 years ago

Intermediate Overall Prediction Electron Density

Summary

Created
February 23, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes a glutathione ligand that is fixed in place.



Sequence:


PAKLGYWKLRGLAQPVRLFLEYLGEEYEEHLYGRDDREKWMSEKFNMGLDLPNLPYYIDDKCKLTQSVAIMRYIADKHGMLGTTPEERARISMIEGAAMDLRIGFGRVCYNPKFEEVKEEYVKELPKTLKMWSDFLGDRHYLTGSSVSHVDFMLYETLDSIRYLAPHCLDEFPKLKEFKSRIEALPKIKAYMESKRFIKWPLNGWAASFGAGDA

Top groups

  1. Avatar for Australia 11. Australia 1 pt. 26,413
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 2,365
  1. Avatar for zippyc137 11. zippyc137 Lv 1 50 pts. 28,270
  2. Avatar for dcrwheeler 12. dcrwheeler Lv 1 46 pts. 28,247
  3. Avatar for WBarme1234 13. WBarme1234 Lv 1 43 pts. 28,191
  4. Avatar for NinjaGreg 14. NinjaGreg Lv 1 40 pts. 28,186
  5. Avatar for Anfinsen_slept_here 15. Anfinsen_slept_here Lv 1 37 pts. 28,182
  6. Avatar for Bletchley Park 16. Bletchley Park Lv 1 34 pts. 28,182
  7. Avatar for guineapig 17. guineapig Lv 1 31 pts. 28,173
  8. Avatar for jausmh 18. jausmh Lv 1 29 pts. 28,171
  9. Avatar for frood66 19. frood66 Lv 1 26 pts. 27,968
  10. Avatar for robgee 20. robgee Lv 1 24 pts. 27,949

Comments