2114: Electron Density Reconstruction 5

Closed since about 4 years ago

Summary

• Created: February 23, 2022
• Expires: March 04, 2022 at 23:00 UTC
• Max points: 100

Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes a glutathione ligand that is fixed in place.



Sequence:

PAKLGYWKLRGLAQPVRLFLEYLGEEYEEHLYGRDDREKWMSEKFNMGLDLPNLPYYIDDKCKLTQSVAIMRYIADKHGMLGTTPEERARISMIEGAAMDLRIGFGRVCYNPKFEEVKEEYVKELPKTLKMWSDFLGDRHYLTGSSVSHVDFMLYETLDSIRYLAPHCLDEFPKLKEFKSRIEALPKIKAYMESKRFIKWPLNGWAASFGAGDA

Top groups

• 1. Go Science 100 pts. 28,663
• 2. Anthropic Dreams 63 pts. 28,597
• 3. Beta Folders 37 pts. 28,597
• 4. Contenders 21 pts. 28,390
• 5. FamilyBarmettler 11 pts. 28,191
• 6. Marvin's bunch 5 pts. 28,171
• 7. Gargleblasters 2 pts. 27,869
• 8. L'Alliance Francophone 1 pt. 27,774
• 9. Void Crushers 1 pt. 27,495
• 10. VeFold 1 pt. 26,556

Top soloists

• 11. zippyc137 50 pts. 28,270
• 12. dcrwheeler 46 pts. 28,247
• 13. WBarme1234 43 pts. 28,191
• 14. NinjaGreg 40 pts. 28,186
• 15. Anfinsen_slept_here 37 pts. 28,182
• 16. Bletchley Park 34 pts. 28,182
• 17. guineapig 31 pts. 28,173
• 18. jausmh 29 pts. 28,171
• 19. frood66 26 pts. 27,968
• 20. robgee 24 pts. 27,949