Placeholder image of a protein
Icon representing a puzzle

2114: Electron Density Reconstruction 5

Closed since about 4 years ago

Intermediate Overall Prediction Electron Density

Summary


Created
February 23, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes a glutathione ligand that is fixed in place.



Sequence:


PAKLGYWKLRGLAQPVRLFLEYLGEEYEEHLYGRDDREKWMSEKFNMGLDLPNLPYYIDDKCKLTQSVAIMRYIADKHGMLGTTPEERARISMIEGAAMDLRIGFGRVCYNPKFEEVKEEYVKELPKTLKMWSDFLGDRHYLTGSSVSHVDFMLYETLDSIRYLAPHCLDEFPKLKEFKSRIEALPKIKAYMESKRFIKWPLNGWAASFGAGDA

Top groups


  1. Avatar for Australia 11. Australia 1 pt. 26,413
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 2,365

  1. Avatar for Arthuriel 51. Arthuriel Lv 1 1 pt. 26,159
  2. Avatar for rinze 52. rinze Lv 1 1 pt. 26,155
  3. Avatar for DScott 53. DScott Lv 1 1 pt. 26,120
  4. Avatar for froschi2 54. froschi2 Lv 1 1 pt. 25,983
  5. Avatar for carxo 55. carxo Lv 1 1 pt. 25,877
  6. Avatar for Mohoernchen 56. Mohoernchen Lv 1 1 pt. 25,869
  7. Avatar for pfirth 57. pfirth Lv 1 1 pt. 25,754
  8. Avatar for NISMO 58. NISMO Lv 1 1 pt. 25,734
  9. Avatar for MythicalPingu 59. MythicalPingu Lv 1 1 pt. 25,466
  10. Avatar for furi0us 60. furi0us Lv 1 1 pt. 25,300

Comments