Placeholder image of a protein
Icon representing a puzzle

2114: Electron Density Reconstruction 5

Closed since about 4 years ago

Intermediate Overall Prediction Electron Density

Summary

Created
February 23, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes a glutathione ligand that is fixed in place.



Sequence:


PAKLGYWKLRGLAQPVRLFLEYLGEEYEEHLYGRDDREKWMSEKFNMGLDLPNLPYYIDDKCKLTQSVAIMRYIADKHGMLGTTPEERARISMIEGAAMDLRIGFGRVCYNPKFEEVKEEYVKELPKTLKMWSDFLGDRHYLTGSSVSHVDFMLYETLDSIRYLAPHCLDEFPKLKEFKSRIEALPKIKAYMESKRFIKWPLNGWAASFGAGDA

Top groups

  1. Avatar for Australia 11. Australia 1 pt. 26,413
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 2,365
  1. Avatar for SloppyPuppy 71. SloppyPuppy Lv 1 1 pt. 2,365
  2. Avatar for Keresto 72. Keresto Lv 1 1 pt. 2,365
  3. Avatar for borattt 73. borattt Lv 1 1 pt. 2,365
  4. Avatar for lcahya 74. lcahya Lv 1 1 pt. 2,365
  5. Avatar for manu8170 75. manu8170 Lv 1 1 pt. 2,365
  6. Avatar for sakshamphul 76. sakshamphul Lv 1 1 pt. 2,365
  7. Avatar for Sciren 77. Sciren Lv 1 1 pt. 2,365

Comments