Placeholder image of a protein
Icon representing a puzzle

2119: Revisiting Puzzle 124: PDZ Domain

Closed since about 4 years ago

Novice Overall Prediction

Summary


Created
March 10, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups


  1. Avatar for Australia 11. Australia 1 pt. 9,910
  2. Avatar for G1051331 12. G1051331 1 pt. 9,550
  3. Avatar for Team China 13. Team China 1 pt. 9,452
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 8,638
  5. Avatar for Window Group 15. Window Group 1 pt. 8,210
  6. Avatar for UML BMEN.4100 16. UML BMEN.4100 1 pt. 8,165
  7. Avatar for Haykapnayan 17. Haykapnayan 1 pt. 8,165

  1. Avatar for cbwest 91. cbwest Lv 1 1 pt. 9,022
  2. Avatar for Zosa 92. Zosa Lv 1 1 pt. 8,919
  3. Avatar for aka_bkoep 93. aka_bkoep Lv 1 1 pt. 8,914
  4. Avatar for bkoep 94. bkoep Lv 1 1 pt. 8,638
  5. Avatar for HuyPham 95. HuyPham Lv 1 1 pt. 8,230
  6. Avatar for jflat06 96. jflat06 Lv 1 1 pt. 8,210
  7. Avatar for lezhe 97. lezhe Lv 1 1 pt. 8,174
  8. Avatar for mayacool4 99. mayacool4 Lv 1 1 pt. 8,165
  9. Avatar for altejoh 100. altejoh Lv 1 1 pt. 8,165

Comments