Placeholder image of a protein
Icon representing a puzzle

2119: Revisiting Puzzle 124: PDZ Domain

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
March 10, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for Australia 11. Australia 1 pt. 9,910
  2. Avatar for G1051331 12. G1051331 1 pt. 9,550
  3. Avatar for Team China 13. Team China 1 pt. 9,452
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 8,638
  5. Avatar for Window Group 15. Window Group 1 pt. 8,210
  6. Avatar for UML BMEN.4100 16. UML BMEN.4100 1 pt. 8,165
  7. Avatar for Haykapnayan 17. Haykapnayan 1 pt. 8,165
  1. Avatar for grogar7 21. grogar7 Lv 1 37 pts. 10,686
  2. Avatar for Skippysk8s 22. Skippysk8s Lv 1 35 pts. 10,684
  3. Avatar for alcor29 23. alcor29 Lv 1 33 pts. 10,684
  4. Avatar for fiendish_ghoul 24. fiendish_ghoul Lv 1 31 pts. 10,670
  5. Avatar for WBarme1234 25. WBarme1234 Lv 1 30 pts. 10,664
  6. Avatar for Sandrix72 26. Sandrix72 Lv 1 28 pts. 10,659
  7. Avatar for Lotus23 27. Lotus23 Lv 1 26 pts. 10,644
  8. Avatar for georg137 28. georg137 Lv 1 25 pts. 10,635
  9. Avatar for akaaka 29. akaaka Lv 1 24 pts. 10,634
  10. Avatar for blazegeek 30. blazegeek Lv 1 22 pts. 10,614

Comments