Placeholder image of a protein
Icon representing a puzzle

2119: Revisiting Puzzle 124: PDZ Domain

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
March 10, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for Australia 11. Australia 1 pt. 9,910
  2. Avatar for G1051331 12. G1051331 1 pt. 9,550
  3. Avatar for Team China 13. Team China 1 pt. 9,452
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 8,638
  5. Avatar for Window Group 15. Window Group 1 pt. 8,210
  6. Avatar for UML BMEN.4100 16. UML BMEN.4100 1 pt. 8,165
  7. Avatar for Haykapnayan 17. Haykapnayan 1 pt. 8,165
  1. Avatar for RockOn 31. RockOn Lv 1 21 pts. 10,613
  2. Avatar for borattt 32. borattt Lv 1 20 pts. 10,596
  3. Avatar for fpc 33. fpc Lv 1 18 pts. 10,589
  4. Avatar for infjamc 34. infjamc Lv 1 17 pts. 10,573
  5. Avatar for ProfVince 35. ProfVince Lv 1 16 pts. 10,567
  6. Avatar for zippyc137 36. zippyc137 Lv 1 15 pts. 10,500
  7. Avatar for maithra 37. maithra Lv 1 14 pts. 10,493
  8. Avatar for PeterDav 38. PeterDav Lv 1 13 pts. 10,477
  9. Avatar for bamh 39. bamh Lv 1 13 pts. 10,447
  10. Avatar for equilibria 40. equilibria Lv 1 12 pts. 10,444

Comments