Placeholder image of a protein
Icon representing a puzzle

2119: Revisiting Puzzle 124: PDZ Domain

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
March 10, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for Australia 11. Australia 1 pt. 9,910
  2. Avatar for G1051331 12. G1051331 1 pt. 9,550
  3. Avatar for Team China 13. Team China 1 pt. 9,452
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 8,638
  5. Avatar for Window Group 15. Window Group 1 pt. 8,210
  6. Avatar for UML BMEN.4100 16. UML BMEN.4100 1 pt. 8,165
  7. Avatar for Haykapnayan 17. Haykapnayan 1 pt. 8,165
  1. Avatar for Vinara 41. Vinara Lv 1 11 pts. 10,419
  2. Avatar for spongiformasquarepantsii 42. spongiformasquarepantsii Lv 1 10 pts. 10,376
  3. Avatar for heather-1 43. heather-1 Lv 1 10 pts. 10,341
  4. Avatar for AlphaFold2 44. AlphaFold2 Lv 1 9 pts. 10,327
  5. Avatar for Merf 45. Merf Lv 1 8 pts. 10,306
  6. Avatar for jsfoldingaccount 46. jsfoldingaccount Lv 1 8 pts. 10,304
  7. Avatar for Idiotboy 47. Idiotboy Lv 1 7 pts. 10,236
  8. Avatar for Deleted player 48. Deleted player 7 pts. 10,229
  9. Avatar for jamiexq 49. jamiexq Lv 1 6 pts. 10,216
  10. Avatar for phi16 50. phi16 Lv 1 6 pts. 10,182

Comments