Placeholder image of a protein
Icon representing a puzzle

2119: Revisiting Puzzle 124: PDZ Domain

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
March 10, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for Australia 11. Australia 1 pt. 9,910
  2. Avatar for G1051331 12. G1051331 1 pt. 9,550
  3. Avatar for Team China 13. Team China 1 pt. 9,452
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 8,638
  5. Avatar for Window Group 15. Window Group 1 pt. 8,210
  6. Avatar for UML BMEN.4100 16. UML BMEN.4100 1 pt. 8,165
  7. Avatar for Haykapnayan 17. Haykapnayan 1 pt. 8,165
  1. Avatar for NeLikomSheet 51. NeLikomSheet Lv 1 5 pts. 10,182
  2. Avatar for Arne Heessels 52. Arne Heessels Lv 1 5 pts. 10,138
  3. Avatar for frostschutz 53. frostschutz Lv 1 5 pts. 10,132
  4. Avatar for kyoota 54. kyoota Lv 1 4 pts. 10,087
  5. Avatar for kevin everington 55. kevin everington Lv 1 4 pts. 10,033
  6. Avatar for Oransche 56. Oransche Lv 1 4 pts. 10,025
  7. Avatar for Trajan464 57. Trajan464 Lv 1 3 pts. 10,021
  8. Avatar for Beany 58. Beany Lv 1 3 pts. 9,982
  9. Avatar for Larini 59. Larini Lv 1 3 pts. 9,973
  10. Avatar for carxo 60. carxo Lv 1 3 pts. 9,937

Comments