Placeholder image of a protein
Icon representing a puzzle

2119: Revisiting Puzzle 124: PDZ Domain

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
March 10, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for Australia 11. Australia 1 pt. 9,910
  2. Avatar for G1051331 12. G1051331 1 pt. 9,550
  3. Avatar for Team China 13. Team China 1 pt. 9,452
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 8,638
  5. Avatar for Window Group 15. Window Group 1 pt. 8,210
  6. Avatar for UML BMEN.4100 16. UML BMEN.4100 1 pt. 8,165
  7. Avatar for Haykapnayan 17. Haykapnayan 1 pt. 8,165
  1. Avatar for tracybutt 61. tracybutt Lv 1 2 pts. 9,923
  2. Avatar for AlkiP0Ps 62. AlkiP0Ps Lv 1 2 pts. 9,910
  3. Avatar for Simek 63. Simek Lv 1 2 pts. 9,902
  4. Avatar for katling 64. katling Lv 1 2 pts. 9,872
  5. Avatar for Dr.Sillem 65. Dr.Sillem Lv 1 2 pts. 9,862
  6. Avatar for zackallen 66. zackallen Lv 1 2 pts. 9,853
  7. Avatar for froschi2 67. froschi2 Lv 1 2 pts. 9,792
  8. Avatar for techy cat 68. techy cat Lv 1 1 pt. 9,743
  9. Avatar for abiogenesis 69. abiogenesis Lv 1 1 pt. 9,687
  10. Avatar for Hellcat6 70. Hellcat6 Lv 1 1 pt. 9,639

Comments