Placeholder image of a protein
Icon representing a puzzle

2119: Revisiting Puzzle 124: PDZ Domain

Closed since almost 4 years ago

Novice Overall Prediction

Summary


Created
March 10, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups


  1. Avatar for Go Science 100 pts. 11,090
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 11,020
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 10,984
  4. Avatar for Contenders 4. Contenders 36 pts. 10,903
  5. Avatar for Marvin's bunch 5. Marvin's bunch 24 pts. 10,837
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 10,822
  7. Avatar for Void Crushers 7. Void Crushers 10 pts. 10,728
  8. Avatar for Gargleblasters 8. Gargleblasters 6 pts. 10,711
  9. Avatar for ProWigglers-AKLab 9. ProWigglers-AKLab 4 pts. 10,376
  10. Avatar for AlphaFold 10. AlphaFold 2 pts. 10,327

  1. Avatar for pfirth 71. pfirth Lv 1 1 pt. 9,619
  2. Avatar for rinze 72. rinze Lv 1 1 pt. 9,606
  3. Avatar for DScott 73. DScott Lv 1 1 pt. 9,599
  4. Avatar for Mohoernchen 74. Mohoernchen Lv 1 1 pt. 9,553
  5. Avatar for pin.pab.2001 75. pin.pab.2001 Lv 1 1 pt. 9,550
  6. Avatar for Lynhn 76. Lynhn Lv 1 1 pt. 9,459
  7. Avatar for zo3xiaJonWeinberg 77. zo3xiaJonWeinberg Lv 1 1 pt. 9,452
  8. Avatar for cyshaw98 78. cyshaw98 Lv 1 1 pt. 9,449
  9. Avatar for Rensat 79. Rensat Lv 1 1 pt. 9,441
  10. Avatar for pruneau_44 80. pruneau_44 Lv 1 1 pt. 9,408

Comments