Placeholder image of a protein
Icon representing a puzzle

2119: Revisiting Puzzle 124: PDZ Domain

Closed since about 4 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
March 10, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups


  1. Avatar for Go Science 100 pts. 11,090
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 11,020
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 10,984
  4. Avatar for Contenders 4. Contenders 36 pts. 10,903
  5. Avatar for Marvin's bunch 5. Marvin's bunch 24 pts. 10,837
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 10,822
  7. Avatar for Void Crushers 7. Void Crushers 10 pts. 10,728
  8. Avatar for Gargleblasters 8. Gargleblasters 6 pts. 10,711
  9. Avatar for ProWigglers-AKLab 9. ProWigglers-AKLab 4 pts. 10,376
  10. Avatar for AlphaFold 10. AlphaFold 2 pts. 10,327

  1. Avatar for TaoZhang 82. TaoZhang Lv 1 1 pt. 9,373
  2. Avatar for Shado165 83. Shado165 Lv 1 1 pt. 9,351
  3. Avatar for furi0us 84. furi0us Lv 1 1 pt. 9,348
  4. Avatar for antibot215 85. antibot215 Lv 1 1 pt. 9,274
  5. Avatar for LeoClaxton 86. LeoClaxton Lv 1 1 pt. 9,273
  6. Avatar for spazmodic 87. spazmodic Lv 1 1 pt. 9,264
  7. Avatar for klbklb 88. klbklb Lv 1 1 pt. 9,232
  8. Avatar for Hebrew Hitman 89. Hebrew Hitman Lv 1 1 pt. 9,119
  9. Avatar for MiracleOfSight 90. MiracleOfSight Lv 1 1 pt. 9,077

Comments