Placeholder image of a protein
Icon representing a puzzle

2122: Revisiting Puzzle 125: Ice Binding Protein

Closed since about 4 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
March 17, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups


  1. Avatar for Team China 11. Team China 2 pts. 9,347
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 8,985
  3. Avatar for UML BMEN.4100 13. UML BMEN.4100 1 pt. 8,877
  4. Avatar for G1051331 14. G1051331 1 pt. 8,404
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 8,315
  6. Avatar for Window Group 16. Window Group 1 pt. 8,126
  7. Avatar for SHELL 17. SHELL 1 pt. 7,023
  8. Avatar for test 2 18. test 2 1 pt. 6,488

  1. Avatar for christioanchauvin 11. christioanchauvin Lv 1 63 pts. 10,115
  2. Avatar for guineapig 12. guineapig Lv 1 60 pts. 10,115
  3. Avatar for Bruno Kestemont 13. Bruno Kestemont Lv 1 57 pts. 10,113
  4. Avatar for Blipperman 14. Blipperman Lv 1 54 pts. 10,111
  5. Avatar for NinjaGreg 15. NinjaGreg Lv 1 51 pts. 10,109
  6. Avatar for g_b 16. g_b Lv 1 49 pts. 10,095
  7. Avatar for frood66 17. frood66 Lv 1 46 pts. 10,089
  8. Avatar for phi16 18. phi16 Lv 1 44 pts. 10,086
  9. Avatar for Bletchley Park 19. Bletchley Park Lv 1 42 pts. 10,081
  10. Avatar for borattt 20. borattt Lv 1 40 pts. 10,079

Comments