Placeholder image of a protein
Icon representing a puzzle

2122: Revisiting Puzzle 125: Ice Binding Protein

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
March 17, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for Team China 11. Team China 2 pts. 9,347
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 8,985
  3. Avatar for UML BMEN.4100 13. UML BMEN.4100 1 pt. 8,877
  4. Avatar for G1051331 14. G1051331 1 pt. 8,404
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 8,315
  6. Avatar for Window Group 16. Window Group 1 pt. 8,126
  7. Avatar for SHELL 17. SHELL 1 pt. 7,023
  8. Avatar for test 2 18. test 2 1 pt. 6,488
  1. Avatar for jsfoldingaccount 41. jsfoldingaccount Lv 1 11 pts. 9,928
  2. Avatar for kyoota 42. kyoota Lv 1 10 pts. 9,928
  3. Avatar for equilibria 43. equilibria Lv 1 10 pts. 9,919
  4. Avatar for dizzywings 44. dizzywings Lv 1 9 pts. 9,907
  5. Avatar for alcor29 45. alcor29 Lv 1 9 pts. 9,903
  6. Avatar for AlphaFold2 46. AlphaFold2 Lv 1 8 pts. 9,902
  7. Avatar for Oransche 47. Oransche Lv 1 7 pts. 9,888
  8. Avatar for Skippysk8s 48. Skippysk8s Lv 1 7 pts. 9,887
  9. Avatar for Vinara 49. Vinara Lv 1 6 pts. 9,867
  10. Avatar for zippyc137 50. zippyc137 Lv 1 6 pts. 9,855

Comments