Placeholder image of a protein
Icon representing a puzzle

2122: Revisiting Puzzle 125: Ice Binding Protein

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
March 17, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for Team China 11. Team China 2 pts. 9,347
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 8,985
  3. Avatar for UML BMEN.4100 13. UML BMEN.4100 1 pt. 8,877
  4. Avatar for G1051331 14. G1051331 1 pt. 8,404
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 8,315
  6. Avatar for Window Group 16. Window Group 1 pt. 8,126
  7. Avatar for SHELL 17. SHELL 1 pt. 7,023
  8. Avatar for test 2 18. test 2 1 pt. 6,488
  1. Avatar for LeoClaxton 81. LeoClaxton Lv 1 1 pt. 9,140
  2. Avatar for Deleted player 82. Deleted player 1 pt. 9,126
  3. Avatar for DScott 83. DScott Lv 1 1 pt. 9,110
  4. Avatar for hada 84. hada Lv 1 1 pt. 9,091
  5. Avatar for Hebrew Hitman 85. Hebrew Hitman Lv 1 1 pt. 9,065
  6. Avatar for dierese 86. dierese Lv 1 1 pt. 9,039
  7. Avatar for Prion_research 87. Prion_research Lv 1 1 pt. 9,033
  8. Avatar for Savas 88. Savas Lv 1 1 pt. 8,985
  9. Avatar for Amynet 89. Amynet Lv 1 1 pt. 8,975
  10. Avatar for Simek 90. Simek Lv 1 1 pt. 8,974

Comments