Placeholder image of a protein
Icon representing a puzzle

2125: Revisiting Puzzle 126: Ethanolamine Utilization

Closed since about 4 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
March 24, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein allows bacteria to metabolize ethanolamine and use it in constructing cell walls and cell membranes. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,877
  2. Avatar for Contenders 2. Contenders 76 pts. 10,777
  3. Avatar for Go Science 3. Go Science 56 pts. 10,720
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 41 pts. 10,489
  5. Avatar for Marvin's bunch 5. Marvin's bunch 29 pts. 10,455
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 10,130
  7. Avatar for AlphaFold 7. AlphaFold 14 pts. 9,872
  8. Avatar for Beta Folders 8. Beta Folders 9 pts. 9,777
  9. Avatar for Coastal Biochemistry 9. Coastal Biochemistry 6 pts. 9,418
  10. Avatar for Australia 10. Australia 4 pts. 9,371

  1. Avatar for Idiotboy 21. Idiotboy Lv 1 47 pts. 10,326
  2. Avatar for Punzi Baker 3 22. Punzi Baker 3 Lv 1 45 pts. 10,323
  3. Avatar for BarrySampson 23. BarrySampson Lv 1 43 pts. 10,281
  4. Avatar for robgee 24. robgee Lv 1 41 pts. 10,229
  5. Avatar for alcor29 25. alcor29 Lv 1 40 pts. 10,144
  6. Avatar for infjamc 26. infjamc Lv 1 38 pts. 10,134
  7. Avatar for Blipperman 27. Blipperman Lv 1 36 pts. 10,130
  8. Avatar for borattt 28. borattt Lv 1 35 pts. 10,102
  9. Avatar for Lotus23 29. Lotus23 Lv 1 33 pts. 10,098
  10. Avatar for akaaka 30. akaaka Lv 1 32 pts. 10,077

Comments