Placeholder image of a protein
Icon representing a puzzle

2125: Revisiting Puzzle 126: Ethanolamine Utilization

Closed since almost 4 years ago

Novice Overall Prediction

Summary

Created
March 24, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein allows bacteria to metabolize ethanolamine and use it in constructing cell walls and cell membranes. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,877
  2. Avatar for Contenders 2. Contenders 76 pts. 10,777
  3. Avatar for Go Science 3. Go Science 56 pts. 10,720
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 41 pts. 10,489
  5. Avatar for Marvin's bunch 5. Marvin's bunch 29 pts. 10,455
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 10,130
  7. Avatar for AlphaFold 7. AlphaFold 14 pts. 9,872
  8. Avatar for Beta Folders 8. Beta Folders 9 pts. 9,777
  9. Avatar for Coastal Biochemistry 9. Coastal Biochemistry 6 pts. 9,418
  10. Avatar for Australia 10. Australia 4 pts. 9,371
  1. Avatar for Oransche 51. Oransche Lv 1 11 pts. 9,502
  2. Avatar for Merf 52. Merf Lv 1 11 pts. 9,469
  3. Avatar for manu8170 53. manu8170 Lv 1 10 pts. 9,445
  4. Avatar for Zosa 54. Zosa Lv 1 10 pts. 9,431
  5. Avatar for Sphingosine 55. Sphingosine Lv 1 9 pts. 9,418
  6. Avatar for equilibria 56. equilibria Lv 1 9 pts. 9,400
  7. Avatar for antibot215 57. antibot215 Lv 1 8 pts. 9,399
  8. Avatar for jcdozler 58. jcdozler Lv 1 8 pts. 9,399
  9. Avatar for hggreene 59. hggreene Lv 1 7 pts. 9,399
  10. Avatar for CarsonMickey 60. CarsonMickey Lv 1 7 pts. 9,377

Comments