Placeholder image of a protein
Icon representing a puzzle

2134: Revisiting Puzzle 136: Cell Adhesion

Closed since about 4 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
April 12, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein, from the venom of the saw-scaled viper, interferes with the cellular adhesion machinery that allows blood clotting. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Top groups

  1. Avatar for Australia 11. Australia 1 pt. 8,276
  2. Avatar for SHELL 12. SHELL 1 pt. 7,045
  3. Avatar for test 2 13. test 2 1 pt. 6,740
  4. Avatar for Haykapnayan 14. Haykapnayan 1 pt. 5,091
  5. Avatar for G1051331 15. G1051331 1 pt. 5,091
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 5,091
  1. Avatar for kevin everington 81. kevin everington Lv 1 1 pt. 7,913
  2. Avatar for DScott 82. DScott Lv 1 1 pt. 7,885
  3. Avatar for kludbrook 83. kludbrook Lv 1 1 pt. 7,831
  4. Avatar for jsfoldingaccount 84. jsfoldingaccount Lv 1 1 pt. 7,658
  5. Avatar for Tyranus21 85. Tyranus21 Lv 1 1 pt. 7,587
  6. Avatar for furi0us 86. furi0us Lv 1 1 pt. 7,413
  7. Avatar for Anfinsen_slept_here 87. Anfinsen_slept_here Lv 1 1 pt. 7,364
  8. Avatar for Mohoernchen 88. Mohoernchen Lv 1 1 pt. 7,201
  9. Avatar for 41922093 89. 41922093 Lv 1 1 pt. 7,045
  10. Avatar for joshtest01 90. joshtest01 Lv 1 1 pt. 6,740

Comments