Placeholder image of a protein
Icon representing a puzzle

2137: Electron Density Reconstruction 7

Closed since almost 4 years ago

Novice Overall Prediction Electron Density

Summary

Created
April 21, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes a glutathione ligand that is fixed in place.



Sequence:


MLSQEFFNSFITIYRPYLKLTEPILEKHNIYYGQWLILRDIAKHQPTTLIEISHRRAIEKPTARKTLKALIENDLITVENSLEDKRQKFLTLTPKGHELYEIVCLDVQKLQQAVVAKTNISQDQMQETINVMNQIHEILLKEA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 16,734
  2. Avatar for Go Science 2. Go Science 68 pts. 16,695
  3. Avatar for Contenders 3. Contenders 44 pts. 16,651
  4. Avatar for Marvin's bunch 4. Marvin's bunch 27 pts. 16,572
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 16,462
  6. Avatar for Gargleblasters 6. Gargleblasters 9 pts. 16,239
  7. Avatar for Australia 7. Australia 5 pts. 15,674
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 3 pts. 15,230
  9. Avatar for VeFold 9. VeFold 1 pt. 15,177
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 14,390
  1. Avatar for Zosa 31. Zosa Lv 1 15 pts. 16,147
  2. Avatar for maithra 32. maithra Lv 1 14 pts. 16,109
  3. Avatar for Vinara 33. Vinara Lv 1 13 pts. 16,086
  4. Avatar for Idiotboy 34. Idiotboy Lv 1 12 pts. 16,048
  5. Avatar for alcor29 35. alcor29 Lv 1 11 pts. 16,046
  6. Avatar for Crossed Sticks 36. Crossed Sticks Lv 1 11 pts. 16,014
  7. Avatar for infjamc 37. infjamc Lv 1 10 pts. 15,893
  8. Avatar for kyoota 38. kyoota Lv 1 9 pts. 15,746
  9. Avatar for AlkiP0Ps 39. AlkiP0Ps Lv 1 8 pts. 15,674
  10. Avatar for fpc 40. fpc Lv 1 8 pts. 15,653

Comments