Placeholder image of a protein
Icon representing a puzzle

2140: Revisiting Puzzle 137: Rosetta Decoy

Closed since almost 4 years ago

Novice Overall Prediction

Summary

Created
April 28, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,903
  2. Avatar for Go Science 2. Go Science 74 pts. 11,768
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 54 pts. 11,714
  4. Avatar for Gargleblasters 4. Gargleblasters 38 pts. 11,639
  5. Avatar for Contenders 5. Contenders 27 pts. 11,629
  6. Avatar for Marvin's bunch 6. Marvin's bunch 18 pts. 11,627
  7. Avatar for GENE 433 7. GENE 433 12 pts. 10,965
  8. Avatar for Australia 8. Australia 8 pts. 10,757
  9. Avatar for Void Crushers 9. Void Crushers 5 pts. 10,619
  10. Avatar for Trinity Biology 10. Trinity Biology 3 pts. 10,265
  1. Avatar for alcor29 41. alcor29 Lv 1 10 pts. 11,179
  2. Avatar for fiendish_ghoul 42. fiendish_ghoul Lv 1 10 pts. 11,149
  3. Avatar for bamh 43. bamh Lv 1 9 pts. 11,140
  4. Avatar for ProfVince 44. ProfVince Lv 1 8 pts. 11,118
  5. Avatar for Deleted player 45. Deleted player 8 pts. 11,114
  6. Avatar for kyoota 46. kyoota Lv 1 7 pts. 11,111
  7. Avatar for MrZanav 47. MrZanav Lv 1 7 pts. 11,111
  8. Avatar for Zosa 48. Zosa Lv 1 6 pts. 11,064
  9. Avatar for Oransche 49. Oransche Lv 1 6 pts. 11,033
  10. Avatar for Beany 50. Beany Lv 1 5 pts. 11,025

Comments