Placeholder image of a protein
Icon representing a puzzle

2176: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since over 3 years ago

Novice Overall Prediction

Summary


Created
July 21, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups


  1. Avatar for Foldit Staff 11. Foldit Staff 1 pt. 8,277

  1. Avatar for cjddig 71. cjddig Lv 1 1 pt. 8,951
  2. Avatar for furi0us 72. furi0us Lv 1 1 pt. 8,942
  3. Avatar for Sarion5 73. Sarion5 Lv 1 1 pt. 8,916
  4. Avatar for Merf 74. Merf Lv 1 1 pt. 8,912
  5. Avatar for mwm64 75. mwm64 Lv 1 1 pt. 8,859
  6. Avatar for robgee 76. robgee Lv 1 1 pt. 8,856
  7. Avatar for yhl 77. yhl Lv 1 1 pt. 8,334
  8. Avatar for Zafira765 78. Zafira765 Lv 1 1 pt. 8,317
  9. Avatar for sdlerm 79. sdlerm Lv 1 1 pt. 8,277
  10. Avatar for jhrcwms 80. jhrcwms Lv 1 1 pt. 8,277

Comments