Placeholder image of a protein
Icon representing a puzzle

2182: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
August 04, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 10,392
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 10,319
  1. Avatar for zippyc137 21. zippyc137 Lv 1 28 pts. 11,741
  2. Avatar for BootsMcGraw 22. BootsMcGraw Lv 1 26 pts. 11,741
  3. Avatar for phi16 23. phi16 Lv 1 24 pts. 11,729
  4. Avatar for sallallami 24. sallallami Lv 1 22 pts. 11,715
  5. Avatar for Bruno Kestemont 25. Bruno Kestemont Lv 1 21 pts. 11,711
  6. Avatar for infjamc 26. infjamc Lv 1 19 pts. 11,705
  7. Avatar for SemperRabbit 27. SemperRabbit Lv 1 18 pts. 11,680
  8. Avatar for fiendish_ghoul 28. fiendish_ghoul Lv 1 17 pts. 11,654
  9. Avatar for Calimero Sombrero 29. Calimero Sombrero Lv 1 15 pts. 11,633
  10. Avatar for alcor29 30. alcor29 Lv 1 14 pts. 11,572

Comments