Placeholder image of a protein
Icon representing a puzzle

2182: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since over 3 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
August 04, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 10,392
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 10,319
  1. Avatar for Dr.Sillem 71. Dr.Sillem Lv 1 1 pt. 10,350
  2. Avatar for pruneau_44 72. pruneau_44 Lv 1 1 pt. 10,339
  3. Avatar for B. A. Beder 73. B. A. Beder Lv 1 1 pt. 10,325
  4. Avatar for bkoep 74. bkoep Lv 1 1 pt. 10,319
  5. Avatar for zbp 75. zbp Lv 1 1 pt. 10,307
  6. Avatar for mart0258 76. mart0258 Lv 1 1 pt. 10,301
  7. Avatar for rinze 77. rinze Lv 1 1 pt. 10,268
  8. Avatar for abiogenesis 78. abiogenesis Lv 1 1 pt. 10,249
  9. Avatar for illex 79. illex Lv 1 1 pt. 10,210
  10. Avatar for evifnoskcaj 80. evifnoskcaj Lv 1 1 pt. 10,191

Comments