Placeholder image of a protein
Icon representing a puzzle

2185: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
August 11, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are scientifically relevant.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Australia 11. Australia 1 pt. 10,846
  2. Avatar for Beta Folders 12. Beta Folders 1 pt. 10,825
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 10,549
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 10,276
  5. Avatar for Window Group 15. Window Group 1 pt. 9,090
  1. Avatar for Raghav Sharma 91. Raghav Sharma Lv 1 1 pt. 9,166
  2. Avatar for joshtest02 92. joshtest02 Lv 1 1 pt. 9,146
  3. Avatar for Gematron 2874 93. Gematron 2874 Lv 1 1 pt. 9,090
  4. Avatar for jflat06 94. jflat06 Lv 1 1 pt. 9,090

Comments