Placeholder image of a protein
Icon representing a puzzle

2185: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
August 11, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are scientifically relevant.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Australia 11. Australia 1 pt. 10,846
  2. Avatar for Beta Folders 12. Beta Folders 1 pt. 10,825
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 10,549
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 10,276
  5. Avatar for Window Group 15. Window Group 1 pt. 9,090
  1. Avatar for Timo van der Laan 11. Timo van der Laan Lv 1 57 pts. 11,368
  2. Avatar for dcrwheeler 12. dcrwheeler Lv 1 54 pts. 11,343
  3. Avatar for fpc 13. fpc Lv 1 51 pts. 11,334
  4. Avatar for BackBuffer 14. BackBuffer Lv 1 48 pts. 11,333
  5. Avatar for phi16 15. phi16 Lv 1 45 pts. 11,316
  6. Avatar for maithra 16. maithra Lv 1 42 pts. 11,308
  7. Avatar for jausmh 17. jausmh Lv 1 39 pts. 11,303
  8. Avatar for guineapig 18. guineapig Lv 1 37 pts. 11,302
  9. Avatar for Bletchley Park 19. Bletchley Park Lv 1 35 pts. 11,292
  10. Avatar for BootsMcGraw 20. BootsMcGraw Lv 1 32 pts. 11,279

Comments