Placeholder image of a protein
Icon representing a puzzle

2185: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since over 3 years ago

Novice Overall Prediction

Summary


Created
August 11, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are scientifically relevant.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups


  1. Avatar for Australia 11. Australia 1 pt. 10,846
  2. Avatar for Beta Folders 12. Beta Folders 1 pt. 10,825
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 10,549
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 10,276
  5. Avatar for Window Group 15. Window Group 1 pt. 9,090

  1. Avatar for alcor29 31. alcor29 Lv 1 15 pts. 11,145
  2. Avatar for fiendish_ghoul 32. fiendish_ghoul Lv 1 14 pts. 11,138
  3. Avatar for ShadowTactics 33. ShadowTactics Lv 1 13 pts. 11,129
  4. Avatar for zippyc137 34. zippyc137 Lv 1 12 pts. 11,099
  5. Avatar for bamh 35. bamh Lv 1 11 pts. 11,087
  6. Avatar for rezaefar 36. rezaefar Lv 1 10 pts. 11,081
  7. Avatar for g_b 37. g_b Lv 1 9 pts. 11,074
  8. Avatar for equilibria 38. equilibria Lv 1 8 pts. 11,066
  9. Avatar for ichwilldiesennamen 39. ichwilldiesennamen Lv 1 8 pts. 11,056
  10. Avatar for ucad 40. ucad Lv 1 7 pts. 11,056

Comments