Placeholder image of a protein
Icon representing a puzzle

2185: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
August 11, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are scientifically relevant.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Australia 11. Australia 1 pt. 10,846
  2. Avatar for Beta Folders 12. Beta Folders 1 pt. 10,825
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 10,549
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 10,276
  5. Avatar for Window Group 15. Window Group 1 pt. 9,090
  1. Avatar for heather-1 41. heather-1 Lv 1 7 pts. 11,017
  2. Avatar for NPrincipi 42. NPrincipi Lv 1 6 pts. 11,011
  3. Avatar for Deleted player 43. Deleted player 5 pts. 11,010
  4. Avatar for MrZanav 44. MrZanav Lv 1 5 pts. 11,005
  5. Avatar for Trajan464 45. Trajan464 Lv 1 5 pts. 10,994
  6. Avatar for lraguette 46. lraguette Lv 1 4 pts. 10,985
  7. Avatar for ProfVince 47. ProfVince Lv 1 4 pts. 10,974
  8. Avatar for Bruno Kestemont 48. Bruno Kestemont Lv 1 3 pts. 10,957
  9. Avatar for Beany 49. Beany Lv 1 3 pts. 10,943
  10. Avatar for sallallami 50. sallallami Lv 1 3 pts. 10,927

Comments