Placeholder image of a protein
Icon representing a puzzle

2185: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
August 11, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are scientifically relevant.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Australia 11. Australia 1 pt. 10,846
  2. Avatar for Beta Folders 12. Beta Folders 1 pt. 10,825
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 10,549
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 10,276
  5. Avatar for Window Group 15. Window Group 1 pt. 9,090
  1. Avatar for ConstantFolder 51. ConstantFolder Lv 1 3 pts. 10,921
  2. Avatar for CharaLilith 52. CharaLilith Lv 1 2 pts. 10,909
  3. Avatar for abiogenesis 53. abiogenesis Lv 1 2 pts. 10,891
  4. Avatar for kyoota 54. kyoota Lv 1 2 pts. 10,887
  5. Avatar for Oransche 55. Oransche Lv 1 2 pts. 10,875
  6. Avatar for Visok 56. Visok Lv 1 2 pts. 10,872
  7. Avatar for Zhang Ruichong 57. Zhang Ruichong Lv 1 1 pt. 10,862
  8. Avatar for Wiz kid 58. Wiz kid Lv 1 1 pt. 10,846
  9. Avatar for tracybutt 59. tracybutt Lv 1 1 pt. 10,825
  10. Avatar for Gonegirl 60. Gonegirl Lv 1 1 pt. 10,803

Comments