Placeholder image of a protein
Icon representing a puzzle

2185: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
August 11, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are scientifically relevant.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Australia 11. Australia 1 pt. 10,846
  2. Avatar for Beta Folders 12. Beta Folders 1 pt. 10,825
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 10,549
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 10,276
  5. Avatar for Window Group 15. Window Group 1 pt. 9,090
  1. Avatar for AlkiP0Ps 61. AlkiP0Ps Lv 1 1 pt. 10,801
  2. Avatar for Merf 62. Merf Lv 1 1 pt. 10,771
  3. Avatar for robgee 63. robgee Lv 1 1 pt. 10,759
  4. Avatar for firejuggler 64. firejuggler Lv 1 1 pt. 10,746
  5. Avatar for Arne Heessels 65. Arne Heessels Lv 1 1 pt. 10,726
  6. Avatar for carxo 66. carxo Lv 1 1 pt. 10,623
  7. Avatar for frostschutz 67. frostschutz Lv 1 1 pt. 10,575
  8. Avatar for mart0258 68. mart0258 Lv 1 1 pt. 10,556
  9. Avatar for dahast.de 69. dahast.de Lv 1 1 pt. 10,549
  10. Avatar for Hellcat6 70. Hellcat6 Lv 1 1 pt. 10,521

Comments