Placeholder image of a protein
Icon representing a puzzle

2188: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
August 18, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups

  1. Avatar for WISE 380 Spring 21 A 11. WISE 380 Spring 21 A 1 pt. 11,335
  2. Avatar for Australia 12. Australia 1 pt. 11,308
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 10,929
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 8,949
  1. Avatar for Idiotboy 11. Idiotboy Lv 1 54 pts. 11,954
  2. Avatar for Galaxie 12. Galaxie Lv 1 51 pts. 11,932
  3. Avatar for gmn 13. gmn Lv 1 48 pts. 11,925
  4. Avatar for jobo0502 14. jobo0502 Lv 1 45 pts. 11,912
  5. Avatar for NPrincipi 15. NPrincipi Lv 1 42 pts. 11,893
  6. Avatar for BootsMcGraw 16. BootsMcGraw Lv 1 39 pts. 11,869
  7. Avatar for NinjaGreg 17. NinjaGreg Lv 1 36 pts. 11,855
  8. Avatar for jausmh 18. jausmh Lv 1 34 pts. 11,852
  9. Avatar for guineapig 19. guineapig Lv 1 31 pts. 11,822
  10. Avatar for infjamc 20. infjamc Lv 1 29 pts. 11,803

Comments