Placeholder image of a protein
Icon representing a puzzle

2188: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
August 18, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,452
  2. Avatar for Go Science 2. Go Science 68 pts. 12,115
  3. Avatar for Marvin's bunch 3. Marvin's bunch 44 pts. 12,042
  4. Avatar for Contenders 4. Contenders 27 pts. 12,033
  5. Avatar for Void Crushers 5. Void Crushers 16 pts. 11,980
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 11,912
  7. Avatar for Gargleblasters 7. Gargleblasters 5 pts. 11,624
  8. Avatar for Team China 8. Team China 3 pts. 11,609
  9. Avatar for SETI.Germany 9. SETI.Germany 1 pt. 11,605
  10. Avatar for Beta Folders 10. Beta Folders 1 pt. 11,480
  1. Avatar for Idiotboy 11. Idiotboy Lv 1 54 pts. 11,954
  2. Avatar for Galaxie 12. Galaxie Lv 1 51 pts. 11,932
  3. Avatar for gmn 13. gmn Lv 1 48 pts. 11,925
  4. Avatar for jobo0502 14. jobo0502 Lv 1 45 pts. 11,912
  5. Avatar for NPrincipi 15. NPrincipi Lv 1 42 pts. 11,893
  6. Avatar for BootsMcGraw 16. BootsMcGraw Lv 1 39 pts. 11,869
  7. Avatar for NinjaGreg 17. NinjaGreg Lv 1 36 pts. 11,855
  8. Avatar for jausmh 18. jausmh Lv 1 34 pts. 11,852
  9. Avatar for guineapig 19. guineapig Lv 1 31 pts. 11,822
  10. Avatar for infjamc 20. infjamc Lv 1 29 pts. 11,803

Comments