Placeholder image of a protein
Icon representing a puzzle

2188: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
August 18, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups

  1. Avatar for WISE 380 Spring 21 A 11. WISE 380 Spring 21 A 1 pt. 11,335
  2. Avatar for Australia 12. Australia 1 pt. 11,308
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 10,929
  4. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 8,949
  1. Avatar for jsfoldingaccount 31. jsfoldingaccount Lv 1 12 pts. 11,639
  2. Avatar for Pazithi 32. Pazithi Lv 1 11 pts. 11,624
  3. Avatar for manu8170 33. manu8170 Lv 1 10 pts. 11,609
  4. Avatar for Zhang Ruichong 34. Zhang Ruichong Lv 1 9 pts. 11,609
  5. Avatar for aendgraend 35. aendgraend Lv 1 9 pts. 11,605
  6. Avatar for fiendish_ghoul 36. fiendish_ghoul Lv 1 8 pts. 11,564
  7. Avatar for rezaefar 37. rezaefar Lv 1 7 pts. 11,541
  8. Avatar for phi16 38. phi16 Lv 1 7 pts. 11,538
  9. Avatar for zippyc137 39. zippyc137 Lv 1 6 pts. 11,533
  10. Avatar for heather-1 40. heather-1 Lv 1 5 pts. 11,519

Comments