Placeholder image of a protein
Icon representing a puzzle

2188: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since almost 4 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 18, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,452
  2. Avatar for Go Science 2. Go Science 68 pts. 12,115
  3. Avatar for Marvin's bunch 3. Marvin's bunch 44 pts. 12,042
  4. Avatar for Contenders 4. Contenders 27 pts. 12,033
  5. Avatar for Void Crushers 5. Void Crushers 16 pts. 11,980
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 11,912
  7. Avatar for Gargleblasters 7. Gargleblasters 5 pts. 11,624
  8. Avatar for Team China 8. Team China 3 pts. 11,609
  9. Avatar for SETI.Germany 9. SETI.Germany 1 pt. 11,605
  10. Avatar for Beta Folders 10. Beta Folders 1 pt. 11,480

  1. Avatar for jsfoldingaccount 31. jsfoldingaccount Lv 1 12 pts. 11,639
  2. Avatar for Pazithi 32. Pazithi Lv 1 11 pts. 11,624
  3. Avatar for manu8170 33. manu8170 Lv 1 10 pts. 11,609
  4. Avatar for Zhang Ruichong 34. Zhang Ruichong Lv 1 9 pts. 11,609
  5. Avatar for aendgraend 35. aendgraend Lv 1 9 pts. 11,605
  6. Avatar for fiendish_ghoul 36. fiendish_ghoul Lv 1 8 pts. 11,564
  7. Avatar for rezaefar 37. rezaefar Lv 1 7 pts. 11,541
  8. Avatar for phi16 38. phi16 Lv 1 7 pts. 11,538
  9. Avatar for zippyc137 39. zippyc137 Lv 1 6 pts. 11,533
  10. Avatar for heather-1 40. heather-1 Lv 1 5 pts. 11,519

Comments