Placeholder image of a protein
Icon representing a puzzle

2188: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
August 18, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,452
  2. Avatar for Go Science 2. Go Science 68 pts. 12,115
  3. Avatar for Marvin's bunch 3. Marvin's bunch 44 pts. 12,042
  4. Avatar for Contenders 4. Contenders 27 pts. 12,033
  5. Avatar for Void Crushers 5. Void Crushers 16 pts. 11,980
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 11,912
  7. Avatar for Gargleblasters 7. Gargleblasters 5 pts. 11,624
  8. Avatar for Team China 8. Team China 3 pts. 11,609
  9. Avatar for SETI.Germany 9. SETI.Germany 1 pt. 11,605
  10. Avatar for Beta Folders 10. Beta Folders 1 pt. 11,480
  1. Avatar for sallallami 51. sallallami Lv 1 2 pts. 11,394
  2. Avatar for andrewxc 52. andrewxc Lv 1 2 pts. 11,358
  3. Avatar for zhanghch 53. zhanghch Lv 1 1 pt. 11,342
  4. Avatar for Merf 54. Merf Lv 1 1 pt. 11,341
  5. Avatar for lraguette 55. lraguette Lv 1 1 pt. 11,335
  6. Avatar for firejuggler 56. firejuggler Lv 1 1 pt. 11,308
  7. Avatar for Wiz kid 57. Wiz kid Lv 1 1 pt. 11,308
  8. Avatar for AlkiP0Ps 58. AlkiP0Ps Lv 1 1 pt. 11,305
  9. Avatar for carxo 59. carxo Lv 1 1 pt. 11,239
  10. Avatar for christioanchauvin 60. christioanchauvin Lv 1 1 pt. 11,107

Comments