Icon representing a puzzle

2200: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since over 3 years ago

Novice Overall Prediction

Summary

Created
September 15, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,698
  2. Avatar for Contenders 2. Contenders 70 pts. 11,442
  3. Avatar for Go Science 3. Go Science 47 pts. 11,429
  4. Avatar for Void Crushers 4. Void Crushers 30 pts. 11,403
  5. Avatar for Marvin's bunch 5. Marvin's bunch 19 pts. 11,271
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 11 pts. 11,247
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 11,205
  8. Avatar for Gargleblasters 8. Gargleblasters 4 pts. 11,098
  9. Avatar for Australia 9. Australia 2 pts. 10,781
  10. Avatar for Ogre's lab 10. Ogre's lab 1 pt. 10,738
  1. Avatar for alcor29 41. alcor29 Lv 1 6 pts. 10,921
  2. Avatar for Trajan464 42. Trajan464 Lv 1 6 pts. 10,919
  3. Avatar for jsfoldingaccount 43. jsfoldingaccount Lv 1 5 pts. 10,914
  4. Avatar for rezaefar 44. rezaefar Lv 1 5 pts. 10,872
  5. Avatar for Gonegirl 45. Gonegirl Lv 1 4 pts. 10,869
  6. Avatar for hada 46. hada Lv 1 4 pts. 10,857
  7. Avatar for Turtle33 47. Turtle33 Lv 1 3 pts. 10,844
  8. Avatar for kyoota 48. kyoota Lv 1 3 pts. 10,825
  9. Avatar for abiogenesis 49. abiogenesis Lv 1 3 pts. 10,810
  10. Avatar for Oransche 50. Oransche Lv 1 3 pts. 10,807

Comments