Icon representing a puzzle

2200: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since over 3 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
September 15, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for CureCoin 11. CureCoin 1 pt. 10,276
  2. Avatar for UML BMEN.4100 12. UML BMEN.4100 1 pt. 9,386
  3. Avatar for Window Group 13. Window Group 1 pt. 9,121
  4. Avatar for RubiscoBobGroup 14. RubiscoBobGroup 1 pt. 9,086
  5. Avatar for Foldit Staff 15. Foldit Staff 1 pt. 9,086

  1. Avatar for alcor29 41. alcor29 Lv 1 6 pts. 10,921
  2. Avatar for Trajan464 42. Trajan464 Lv 1 6 pts. 10,919
  3. Avatar for jsfoldingaccount 43. jsfoldingaccount Lv 1 5 pts. 10,914
  4. Avatar for rezaefar 44. rezaefar Lv 1 5 pts. 10,872
  5. Avatar for Gonegirl 45. Gonegirl Lv 1 4 pts. 10,869
  6. Avatar for hada 46. hada Lv 1 4 pts. 10,857
  7. Avatar for Turtle33 47. Turtle33 Lv 1 3 pts. 10,844
  8. Avatar for kyoota 48. kyoota Lv 1 3 pts. 10,825
  9. Avatar for abiogenesis 49. abiogenesis Lv 1 3 pts. 10,810
  10. Avatar for Oransche 50. Oransche Lv 1 3 pts. 10,807

Comments