Icon representing a puzzle

2209: Electron Density Reconstruction 14

Closed since over 3 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
September 29, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
ITRTISKAKGPPRIPEVYLLPPPRNELSKKKVSLTCMITGFYPADINVEWDSSEPSDYKNTPPVFDTDGSFFLYSRLKVDTDAWNNGESFTCSVMHEALPNHVIQKSISRSPG

Top groups


  1. Avatar for Go Science 100 pts. 14,470
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 14,431
  3. Avatar for Contenders 3. Contenders 47 pts. 14,304
  4. Avatar for Gargleblasters 4. Gargleblasters 30 pts. 14,080
  5. Avatar for Void Crushers 5. Void Crushers 19 pts. 13,893
  6. Avatar for Marvin's bunch 6. Marvin's bunch 11 pts. 13,874
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 13,710
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 4 pts. 13,416
  9. Avatar for Russian team 9. Russian team 2 pts. 12,917
  10. Avatar for Australia 10. Australia 1 pt. 12,869

  1. Avatar for BackBuffer 11. BackBuffer Lv 1 55 pts. 14,147
  2. Avatar for NinjaGreg 12. NinjaGreg Lv 1 52 pts. 14,144
  3. Avatar for Bletchley Park 13. Bletchley Park Lv 1 49 pts. 14,113
  4. Avatar for akaaka 14. akaaka Lv 1 45 pts. 14,109
  5. Avatar for gmn 15. gmn Lv 1 43 pts. 14,104
  6. Avatar for guineapig 16. guineapig Lv 1 40 pts. 14,087
  7. Avatar for Pazithi 17. Pazithi Lv 1 37 pts. 14,080
  8. Avatar for Vinara 18. Vinara Lv 1 35 pts. 14,074
  9. Avatar for drjr 19. drjr Lv 1 32 pts. 14,065
  10. Avatar for sallallami 20. sallallami Lv 1 30 pts. 14,060

Comments